Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 1022821..1023368 | Replicon | chromosome |
| Accession | NZ_CP110189 | ||
| Organism | Vibrio cholerae strain E1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OFY13_RS18010 | Protein ID | WP_000229316.1 |
| Coordinates | 1022821..1023123 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | OFY13_RS18015 | Protein ID | WP_000861987.1 |
| Coordinates | 1023111..1023368 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OFY13_RS17975 (OFY13_17975) | 1018193..1019382 | + | 1190 | WP_088124793.1 | IS3 family transposase | - |
| OFY13_RS17980 (OFY13_17980) | 1019391..1019918 | - | 528 | Protein_876 | DUF3800 domain-containing protein | - |
| OFY13_RS17985 (OFY13_17985) | 1019968..1020036 | - | 69 | Protein_877 | GNAT family N-acetyltransferase | - |
| OFY13_RS17990 (OFY13_17990) | 1020093..1020518 | - | 426 | WP_002045007.1 | GNAT family N-acetyltransferase | - |
| OFY13_RS17995 (OFY13_17995) | 1020654..1021043 | - | 390 | WP_001081302.1 | hypothetical protein | - |
| OFY13_RS18000 (OFY13_18000) | 1021218..1021460 | - | 243 | WP_000107462.1 | hypothetical protein | - |
| OFY13_RS18005 (OFY13_18005) | 1021668..1022585 | - | 918 | WP_000186328.1 | alpha/beta hydrolase | - |
| OFY13_RS18010 (OFY13_18010) | 1022821..1023123 | - | 303 | WP_000229316.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OFY13_RS18015 (OFY13_18015) | 1023111..1023368 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OFY13_RS18020 (OFY13_18020) | 1023450..1023560 | - | 111 | WP_100245224.1 | DUF3265 domain-containing protein | - |
| OFY13_RS18025 (OFY13_18025) | 1023570..1024103 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
| OFY13_RS18030 (OFY13_18030) | 1024100..1024369 | - | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
| OFY13_RS18035 (OFY13_18035) | 1024592..1024963 | - | 372 | WP_001164078.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| OFY13_RS18040 (OFY13_18040) | 1025211..1025471 | - | 261 | WP_032468027.1 | DUF3709 domain-containing protein | - |
| OFY13_RS18045 (OFY13_18045) | 1025496..1025620 | - | 125 | Protein_889 | hypothetical protein | - |
| OFY13_RS18050 (OFY13_18050) | 1025630..1025746 | - | 117 | WP_088124786.1 | DUF3265 domain-containing protein | - |
| OFY13_RS18055 (OFY13_18055) | 1025743..1026360 | - | 618 | WP_000695406.1 | hypothetical protein | - |
| OFY13_RS18060 (OFY13_18060) | 1026562..1026688 | - | 127 | Protein_892 | DUF645 family protein | - |
| OFY13_RS18065 (OFY13_18065) | 1026685..1026810 | - | 126 | WP_080388997.1 | general secretion pathway protein GspH | - |
| OFY13_RS18070 (OFY13_18070) | 1027032..1027319 | - | 288 | WP_000426470.1 | hypothetical protein | - |
| OFY13_RS18075 (OFY13_18075) | 1027471..1028139 | - | 669 | WP_000043871.1 | hypothetical protein | - |
| OFY13_RS18080 (OFY13_18080) | 1028156..1028218 | - | 63 | Protein_896 | acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1003220..1033507 | 30287 | |
| - | inside | Integron | - | hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA | 44..1062811 | 1062767 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11753.71 Da Isoelectric Point: 5.1972
>T263348 WP_000229316.1 NZ_CP110189:c1023123-1022821 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|