Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1012505..1013064 Replicon chromosome
Accession NZ_CP110189
Organism Vibrio cholerae strain E1

Toxin (Protein)


Gene name relE Uniprot ID D7HHK2
Locus tag OFY13_RS17920 Protein ID WP_000578471.1
Coordinates 1012786..1013064 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag OFY13_RS17915 Protein ID WP_000381183.1
Coordinates 1012505..1012789 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OFY13_RS17900 (OFY13_17900) 1009466..1010644 - 1179 Protein_860 IS3-like element ISVch4 family transposase -
OFY13_RS17905 (OFY13_17905) 1011199..1011612 - 414 WP_000049420.1 VOC family protein -
OFY13_RS17910 (OFY13_17910) 1011796..1012311 - 516 WP_000343779.1 GNAT family protein -
OFY13_RS17915 (OFY13_17915) 1012505..1012789 + 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OFY13_RS17920 (OFY13_17920) 1012786..1013064 + 279 WP_000578471.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
OFY13_RS17925 (OFY13_17925) 1013203..1013598 - 396 WP_001000868.1 hypothetical protein -
OFY13_RS17930 (OFY13_17930) 1013849..1013974 - 126 WP_001905700.1 DUF645 family protein -
OFY13_RS17935 (OFY13_17935) 1014273..1014794 - 522 WP_000921691.1 DUF2442 domain-containing protein -
OFY13_RS17940 (OFY13_17940) 1014788..1015057 - 270 WP_001114075.1 DUF4160 domain-containing protein -
OFY13_RS17945 (OFY13_17945) 1015564..1015635 - 72 Protein_869 iron transporter -
OFY13_RS17950 (OFY13_17950) 1015692..1016228 - 537 WP_000469484.1 GNAT family protein -
OFY13_RS17955 (OFY13_17955) 1016516..1016734 - 219 Protein_871 DUF3709 domain-containing protein -
OFY13_RS17960 (OFY13_17960) 1016777..1016839 - 63 WP_229636691.1 hypothetical protein -
OFY13_RS17965 (OFY13_17965) 1017022..1017621 - 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1003220..1033507 30287
- inside Integron - hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA 44..1062811 1062767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10838.56 Da        Isoelectric Point: 4.6794

>T263346 WP_000578471.1 NZ_CP110189:1012786-1013064 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAEKTDELIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT263346 WP_000381183.1 NZ_CP110189:1012505-1012789 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VKS2

Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References