Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4003928..4004547 | Replicon | chromosome |
| Accession | NZ_CP110170 | ||
| Organism | Klebsiella pneumoniae strain YZ22PK089 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OK017_RS19850 | Protein ID | WP_002892050.1 |
| Coordinates | 4004329..4004547 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | OK017_RS19845 | Protein ID | WP_002892066.1 |
| Coordinates | 4003928..4004302 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK017_RS19835 (3999080) | 3999080..4000273 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OK017_RS19840 (4000296) | 4000296..4003442 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OK017_RS19845 (4003928) | 4003928..4004302 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| OK017_RS19850 (4004329) | 4004329..4004547 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OK017_RS19855 (4004710) | 4004710..4005276 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| OK017_RS19860 (4005248) | 4005248..4005388 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| OK017_RS19865 (4005409) | 4005409..4005879 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| OK017_RS19870 (4005854) | 4005854..4007305 | - | 1452 | WP_064151794.1 | PLP-dependent aminotransferase family protein | - |
| OK017_RS19875 (4007406) | 4007406..4008104 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| OK017_RS19880 (4008101) | 4008101..4008241 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OK017_RS19885 (4008241) | 4008241..4008504 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263338 WP_002892050.1 NZ_CP110170:4004329-4004547 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT263338 WP_002892066.1 NZ_CP110170:4003928-4004302 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |