Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4003928..4004547 Replicon chromosome
Accession NZ_CP110170
Organism Klebsiella pneumoniae strain YZ22PK089

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OK017_RS19850 Protein ID WP_002892050.1
Coordinates 4004329..4004547 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OK017_RS19845 Protein ID WP_002892066.1
Coordinates 4003928..4004302 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK017_RS19835 (3999080) 3999080..4000273 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OK017_RS19840 (4000296) 4000296..4003442 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OK017_RS19845 (4003928) 4003928..4004302 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OK017_RS19850 (4004329) 4004329..4004547 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OK017_RS19855 (4004710) 4004710..4005276 + 567 WP_002892030.1 maltose O-acetyltransferase -
OK017_RS19860 (4005248) 4005248..4005388 - 141 WP_004147370.1 hypothetical protein -
OK017_RS19865 (4005409) 4005409..4005879 + 471 WP_002892026.1 YlaC family protein -
OK017_RS19870 (4005854) 4005854..4007305 - 1452 WP_064151794.1 PLP-dependent aminotransferase family protein -
OK017_RS19875 (4007406) 4007406..4008104 + 699 WP_002892021.1 GNAT family protein -
OK017_RS19880 (4008101) 4008101..4008241 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OK017_RS19885 (4008241) 4008241..4008504 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263338 WP_002892050.1 NZ_CP110170:4004329-4004547 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263338 WP_002892066.1 NZ_CP110170:4003928-4004302 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References