Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 838786..839590 | Replicon | chromosome |
Accession | NZ_CP110170 | ||
Organism | Klebsiella pneumoniae strain YZ22PK089 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | OK017_RS04160 | Protein ID | WP_186980539.1 |
Coordinates | 839201..839590 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | OK017_RS04155 | Protein ID | WP_285814060.1 |
Coordinates | 838786..839145 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK017_RS04125 (834676) | 834676..835764 | + | 1089 | WP_065523308.1 | patatin-like phospholipase family protein | - |
OK017_RS04130 (835900) | 835900..836058 | - | 159 | Protein_810 | transposase | - |
OK017_RS04135 (836731) | 836731..837552 | + | 822 | WP_065523307.1 | DUF932 domain-containing protein | - |
OK017_RS04140 (837586) | 837586..838035 | + | 450 | WP_094545028.1 | antirestriction protein | - |
OK017_RS04145 (838047) | 838047..838526 | + | 480 | WP_186980535.1 | DNA repair protein RadC | - |
OK017_RS04150 (838540) | 838540..838761 | + | 222 | WP_186980537.1 | DUF987 domain-containing protein | - |
OK017_RS04155 (838786) | 838786..839145 | + | 360 | WP_285814060.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OK017_RS04160 (839201) | 839201..839590 | + | 390 | WP_186980539.1 | TA system toxin CbtA family protein | Toxin |
OK017_RS04165 (839677) | 839677..840516 | + | 840 | WP_186980541.1 | DUF4942 domain-containing protein | - |
OK017_RS04170 (840857) | 840857..842245 | - | 1389 | WP_032420562.1 | MFS transporter | - |
OK017_RS04175 (842375) | 842375..843304 | + | 930 | WP_048993420.1 | LysR family transcriptional regulator | - |
OK017_RS04180 (843668) | 843668..844471 | - | 804 | WP_014906953.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 807429..839590 | 32161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14334.27 Da Isoelectric Point: 8.5682
>T263332 WP_186980539.1 NZ_CP110170:839201-839590 [Klebsiella pneumoniae]
MQTKSSPLMRAASSHPSPVGVWQTLLTSLLEHHYGLTLSDTPFSDEQVIQQHIEAGISLADALNFIVEKYELVRTDRQGF
SIREQSPFITPIDILRARKATGLMNLGTYKDVTAITKGQHQQANTSGKR
MQTKSSPLMRAASSHPSPVGVWQTLLTSLLEHHYGLTLSDTPFSDEQVIQQHIEAGISLADALNFIVEKYELVRTDRQGF
SIREQSPFITPIDILRARKATGLMNLGTYKDVTAITKGQHQQANTSGKR
Download Length: 390 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13397.37 Da Isoelectric Point: 7.7704
>AT263332 WP_285814060.1 NZ_CP110170:838786-839145 [Klebsiella pneumoniae]
MSKKTTITTHDISEPWWGLRRSVSPCFGARLVQEGNRLHYLADRANFDCQPVNADLRHLDQAFPVLMKQLELMLTSGELN
PRHQHCVKLYAKGLTCEADTLGSHGYVYIAIYPTPVATA
MSKKTTITTHDISEPWWGLRRSVSPCFGARLVQEGNRLHYLADRANFDCQPVNADLRHLDQAFPVLMKQLELMLTSGELN
PRHQHCVKLYAKGLTCEADTLGSHGYVYIAIYPTPVATA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|