Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 797892..798549 | Replicon | chromosome |
Accession | NZ_CP110170 | ||
Organism | Klebsiella pneumoniae strain YZ22PK089 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OK017_RS03960 | Protein ID | WP_002916310.1 |
Coordinates | 798139..798549 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OK017_RS03955 | Protein ID | WP_002916312.1 |
Coordinates | 797892..798158 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK017_RS03930 (793048) | 793048..794481 | - | 1434 | WP_064152027.1 | 6-phospho-beta-glucosidase | - |
OK017_RS03935 (794600) | 794600..795328 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
OK017_RS03940 (795378) | 795378..795689 | + | 312 | WP_064152028.1 | N(4)-acetylcytidine aminohydrolase | - |
OK017_RS03945 (795853) | 795853..796512 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
OK017_RS03950 (796663) | 796663..797646 | - | 984 | WP_064152029.1 | tRNA-modifying protein YgfZ | - |
OK017_RS03955 (797892) | 797892..798158 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OK017_RS03960 (798139) | 798139..798549 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
OK017_RS03965 (798556) | 798556..799077 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
OK017_RS03970 (799178) | 799178..800074 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
OK017_RS03975 (800097) | 800097..800810 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OK017_RS03980 (800816) | 800816..802549 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T263331 WP_002916310.1 NZ_CP110170:798139-798549 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |