Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5872..6397 Replicon plasmid pYZ22CS094_2
Accession NZ_CP110169
Organism Klebsiella pneumoniae strain YZ22CS094

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag OK019_RS27720 Protein ID WP_013023785.1
Coordinates 5872..6177 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag OK019_RS27725 Protein ID WP_001568025.1
Coordinates 6179..6397 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK019_RS27690 1567..2193 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
OK019_RS27695 2190..2492 + 303 WP_004197636.1 hypothetical protein -
OK019_RS27700 2948..3742 - 795 WP_004197635.1 site-specific integrase -
OK019_RS27705 3940..4956 - 1017 WP_017899884.1 hypothetical protein -
OK019_RS27710 4967..5281 - 315 WP_053389906.1 hypothetical protein -
OK019_RS27715 5308..5703 - 396 WP_017899885.1 hypothetical protein -
OK019_RS27720 5872..6177 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
OK019_RS27725 6179..6397 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OK019_RS27730 7028..7183 + 156 WP_285813924.1 hypothetical protein -
OK019_RS27735 7220..7924 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
OK019_RS27740 8043..8333 - 291 WP_013023783.1 hypothetical protein -
OK019_RS27745 8330..9457 - 1128 WP_013023782.1 DUF4238 domain-containing protein -
OK019_RS27750 9491..11083 - 1593 WP_015344964.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(6')-Ib-cr / floR / tet(A) / mph(A) / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / blaTEM-1B / blaCTX-M-3 / qnrS1 - 1..131266 131266
- flank IS/Tn - - 7220..7924 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T263329 WP_013023785.1 NZ_CP110169:c6177-5872 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT263329 WP_001568025.1 NZ_CP110169:c6397-6179 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References