Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 167906..168549 | Replicon | plasmid pYZ22CS094_1 |
| Accession | NZ_CP110168 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS094 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A155IU92 |
| Locus tag | OK019_RS27225 | Protein ID | WP_000754567.1 |
| Coordinates | 168133..168549 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | OK019_RS27220 | Protein ID | WP_001261275.1 |
| Coordinates | 167906..168136 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK019_RS27205 | 163736..165328 | + | 1593 | WP_227591599.1 | hypothetical protein | - |
| OK019_RS27215 | 166628..167653 | + | 1026 | WP_227591611.1 | nuclease domain-containing protein | - |
| OK019_RS27220 | 167906..168136 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OK019_RS27225 | 168133..168549 | + | 417 | WP_000754567.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OK019_RS27230 | 168730..169749 | - | 1020 | WP_064160291.1 | fimbrial protein | - |
| OK019_RS27235 | 169770..172163 | - | 2394 | WP_064163930.1 | fimbria/pilus outer membrane usher protein | - |
| OK019_RS27240 | 172175..172870 | - | 696 | WP_064160295.1 | molecular chaperone | - |
| OK019_RS27245 | 172929..173498 | - | 570 | WP_064160296.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | qnrB4 / blaDHA-1 / sul1 / armA / msr(E) / mph(E) / aph(3')-Ia / aph(3'')-Ib / aph(6)-Id / aph(4)-Ia / aac(3)-IVa / sul3 / ant(3'')-Ia / cmlA1 / aadA2 | pla | 1..262096 | 262096 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15108.61 Da Isoelectric Point: 8.5403
>T263327 WP_000754567.1 NZ_CP110168:168133-168549 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A155IU92 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A853H7M9 |