Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4768735..4769251 | Replicon | chromosome |
Accession | NZ_CP110167 | ||
Organism | Klebsiella pneumoniae strain YZ22CS094 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OK019_RS23650 | Protein ID | WP_004178374.1 |
Coordinates | 4768735..4769019 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OK019_RS23655 | Protein ID | WP_002886901.1 |
Coordinates | 4769009..4769251 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK019_RS23625 (4764130) | 4764130..4764393 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
OK019_RS23630 (4764523) | 4764523..4764696 | + | 174 | WP_032412860.1 | hypothetical protein | - |
OK019_RS23635 (4764699) | 4764699..4765442 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OK019_RS23640 (4765799) | 4765799..4767937 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OK019_RS23645 (4768267) | 4768267..4768731 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OK019_RS23650 (4768735) | 4768735..4769019 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK019_RS23655 (4769009) | 4769009..4769251 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OK019_RS23660 (4769329) | 4769329..4771239 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
OK019_RS23665 (4771262) | 4771262..4772416 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
OK019_RS23670 (4772483) | 4772483..4773223 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T263323 WP_004178374.1 NZ_CP110167:c4769019-4768735 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |