Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4050609..4051228 | Replicon | chromosome |
| Accession | NZ_CP110167 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS094 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OK019_RS20250 | Protein ID | WP_002892050.1 |
| Coordinates | 4051010..4051228 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | OK019_RS20245 | Protein ID | WP_002892066.1 |
| Coordinates | 4050609..4050983 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK019_RS20235 (4045761) | 4045761..4046954 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OK019_RS20240 (4046977) | 4046977..4050123 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OK019_RS20245 (4050609) | 4050609..4050983 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| OK019_RS20250 (4051010) | 4051010..4051228 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OK019_RS20255 (4051391) | 4051391..4051957 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| OK019_RS20260 (4051929) | 4051929..4052069 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| OK019_RS20265 (4052090) | 4052090..4052560 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| OK019_RS20270 (4052535) | 4052535..4053986 | - | 1452 | WP_064151794.1 | PLP-dependent aminotransferase family protein | - |
| OK019_RS20275 (4054087) | 4054087..4054785 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| OK019_RS20280 (4054782) | 4054782..4054922 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OK019_RS20285 (4054922) | 4054922..4055185 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263321 WP_002892050.1 NZ_CP110167:4051010-4051228 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT263321 WP_002892066.1 NZ_CP110167:4050609-4050983 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |