Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4050609..4051228 Replicon chromosome
Accession NZ_CP110167
Organism Klebsiella pneumoniae strain YZ22CS094

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OK019_RS20250 Protein ID WP_002892050.1
Coordinates 4051010..4051228 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OK019_RS20245 Protein ID WP_002892066.1
Coordinates 4050609..4050983 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK019_RS20235 (4045761) 4045761..4046954 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OK019_RS20240 (4046977) 4046977..4050123 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OK019_RS20245 (4050609) 4050609..4050983 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OK019_RS20250 (4051010) 4051010..4051228 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OK019_RS20255 (4051391) 4051391..4051957 + 567 WP_002892030.1 maltose O-acetyltransferase -
OK019_RS20260 (4051929) 4051929..4052069 - 141 WP_004147370.1 hypothetical protein -
OK019_RS20265 (4052090) 4052090..4052560 + 471 WP_002892026.1 YlaC family protein -
OK019_RS20270 (4052535) 4052535..4053986 - 1452 WP_064151794.1 PLP-dependent aminotransferase family protein -
OK019_RS20275 (4054087) 4054087..4054785 + 699 WP_002892021.1 GNAT family protein -
OK019_RS20280 (4054782) 4054782..4054922 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OK019_RS20285 (4054922) 4054922..4055185 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263321 WP_002892050.1 NZ_CP110167:4051010-4051228 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263321 WP_002892066.1 NZ_CP110167:4050609-4050983 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References