Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 23948..24470 Replicon plasmid unnamed3
Accession NZ_CP110163
Organism Klebsiella pneumoniae strain YZ22CS089

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag OMD38_RS28610 Protein ID WP_000220561.1
Coordinates 24189..24470 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag OMD38_RS28605 Protein ID WP_000121743.1
Coordinates 23948..24199 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD38_RS28580 (19187) 19187..20047 + 861 WP_063122221.1 hypothetical protein -
OMD38_RS28585 (20068) 20068..20424 - 357 WP_001714234.1 DNA distortion polypeptide 3 -
OMD38_RS28590 (20561) 20561..21007 - 447 WP_001074384.1 hypothetical protein -
OMD38_RS28595 (21011) 21011..21853 - 843 WP_000435064.1 replication initiation protein -
OMD38_RS28600 (21874) 21874..22713 - 840 WP_001352874.1 replication initiation protein -
OMD38_RS28605 (23948) 23948..24199 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
OMD38_RS28610 (24189) 24189..24470 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OMD38_RS28615 (24820) 24820..25335 + 516 WP_001025387.1 J domain-containing protein -
OMD38_RS28620 (25409) 25409..25957 + 549 WP_001178641.1 hypothetical protein -
OMD38_RS28625 (25966) 25966..26235 + 270 WP_001006718.1 hypothetical protein -
OMD38_RS28630 (26225) 26225..26467 + 243 WP_000008708.1 hypothetical protein -
OMD38_RS28635 (26600) 26600..27304 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
OMD38_RS28640 (27310) 27310..27450 + 141 WP_001044210.1 hypothetical protein -
OMD38_RS28645 (27936) 27936..28673 + 738 WP_001446887.1 recombinase family protein -
OMD38_RS28650 (28670) 28670..28894 + 225 WP_000743213.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid floR - 1..30049 30049
- flank IS/Tn - - 26600..27304 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T263313 WP_000220561.1 NZ_CP110163:24189-24470 [Klebsiella pneumoniae]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT263313 WP_000121743.1 NZ_CP110163:23948-24199 [Klebsiella pneumoniae]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References