Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 6262..7172 Replicon plasmid unnamed1
Accession NZ_CP110161
Organism Klebsiella pneumoniae strain YZ22CS089

Toxin (Protein)


Gene name - Uniprot ID R4YBC5
Locus tag OMD38_RS26920 Protein ID WP_004144067.1
Coordinates 6702..7172 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A7H4PRG4
Locus tag OMD38_RS26915 Protein ID WP_032413443.1
Coordinates 6262..6705 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD38_RS26875 1833..2572 - 740 Protein_1 tyrosine-type recombinase/integrase -
OMD38_RS26880 2675..2815 - 141 Protein_2 hypothetical protein -
OMD38_RS26885 2922..3195 + 274 Protein_3 IS3 family transposase -
OMD38_RS26890 3333..3869 - 537 WP_023288364.1 hypothetical protein -
OMD38_RS26895 4080..4319 - 240 Protein_5 transposase -
OMD38_RS26900 4418..5344 - 927 WP_264870072.1 IS5-like element IS903B family transposase -
OMD38_RS26905 5364..5549 + 186 WP_104158587.1 DUF2188 domain-containing protein -
OMD38_RS26910 5650..6162 + 513 Protein_8 DUF4113 domain-containing protein -
OMD38_RS26915 6262..6705 + 444 WP_032413443.1 DUF2384 domain-containing protein Antitoxin
OMD38_RS26920 6702..7172 + 471 WP_004144067.1 RES family NAD+ phosphorylase Toxin
OMD38_RS26925 7282..7542 - 261 WP_104158585.1 hypothetical protein -
OMD38_RS26930 8013..8981 + 969 WP_023279773.1 IS5 family transposase -
OMD38_RS26935 9308..10677 + 1370 WP_085956500.1 IS3-like element ISKpn8 family transposase -
OMD38_RS26940 10748..11809 - 1062 WP_104158586.1 IS481-like element ISKpn28 family transposase -
OMD38_RS26945 11881..12042 + 162 WP_004118124.1 type I toxin-antitoxin system Hok family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 - 1..239545 239545
- inside IScluster/Tn - - 4080..13247 9167


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre

(16-147)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17573.83 Da        Isoelectric Point: 4.5152

>T263309 WP_004144067.1 NZ_CP110161:6702-7172 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16508.82 Da        Isoelectric Point: 10.3013

>AT263309 WP_032413443.1 NZ_CP110161:6262-6705 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A384IED8

Antitoxin

Source ID Structure
AlphaFold DB A0A7H4PRG4

References