Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5377660..5378285 | Replicon | chromosome |
| Accession | NZ_CP110160 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS089 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | OMD38_RS26505 | Protein ID | WP_002882817.1 |
| Coordinates | 5377660..5378043 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | OMD38_RS26510 | Protein ID | WP_004150355.1 |
| Coordinates | 5378043..5378285 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD38_RS26490 (5375026) | 5375026..5375928 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| OMD38_RS26495 (5375925) | 5375925..5376560 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OMD38_RS26500 (5376557) | 5376557..5377486 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| OMD38_RS26505 (5377660) | 5377660..5378043 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OMD38_RS26510 (5378043) | 5378043..5378285 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| OMD38_RS26515 (5378490) | 5378490..5379407 | + | 918 | WP_004181612.1 | alpha/beta hydrolase | - |
| OMD38_RS26520 (5379421) | 5379421..5380362 | - | 942 | WP_285806404.1 | fatty acid biosynthesis protein FabY | - |
| OMD38_RS26525 (5380407) | 5380407..5380844 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| OMD38_RS26530 (5380841) | 5380841..5381701 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| OMD38_RS26535 (5381695) | 5381695..5382294 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T263308 WP_002882817.1 NZ_CP110160:c5378043-5377660 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |