Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4908079..4908595 | Replicon | chromosome |
Accession | NZ_CP110160 | ||
Organism | Klebsiella pneumoniae strain YZ22CS089 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OMD38_RS24265 | Protein ID | WP_004178374.1 |
Coordinates | 4908079..4908363 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OMD38_RS24270 | Protein ID | WP_002886901.1 |
Coordinates | 4908353..4908595 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD38_RS24240 (4903563) | 4903563..4903826 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
OMD38_RS24245 (4903956) | 4903956..4904129 | + | 174 | WP_032408826.1 | hypothetical protein | - |
OMD38_RS24250 (4904132) | 4904132..4904875 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OMD38_RS24255 (4905232) | 4905232..4907370 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OMD38_RS24260 (4907611) | 4907611..4908075 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OMD38_RS24265 (4908079) | 4908079..4908363 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMD38_RS24270 (4908353) | 4908353..4908595 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OMD38_RS24275 (4908673) | 4908673..4910583 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
OMD38_RS24280 (4910606) | 4910606..4911760 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
OMD38_RS24285 (4911827) | 4911827..4912567 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T263306 WP_004178374.1 NZ_CP110160:c4908363-4908079 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |