Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4146719..4147338 Replicon chromosome
Accession NZ_CP110160
Organism Klebsiella pneumoniae strain YZ22CS089

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OMD38_RS20725 Protein ID WP_002892050.1
Coordinates 4147120..4147338 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OMD38_RS20720 Protein ID WP_002892066.1
Coordinates 4146719..4147093 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD38_RS20710 (4141871) 4141871..4143064 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OMD38_RS20715 (4143087) 4143087..4146233 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OMD38_RS20720 (4146719) 4146719..4147093 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OMD38_RS20725 (4147120) 4147120..4147338 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OMD38_RS20730 (4147497) 4147497..4148063 + 567 WP_002892030.1 maltose O-acetyltransferase -
OMD38_RS20735 (4148035) 4148035..4148175 - 141 WP_004147370.1 hypothetical protein -
OMD38_RS20740 (4148196) 4148196..4148666 + 471 WP_002892026.1 YlaC family protein -
OMD38_RS20745 (4148641) 4148641..4150092 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OMD38_RS20750 (4150193) 4150193..4150891 + 699 WP_002892021.1 GNAT family protein -
OMD38_RS20755 (4150888) 4150888..4151028 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OMD38_RS20760 (4151028) 4151028..4151291 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263304 WP_002892050.1 NZ_CP110160:4147120-4147338 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263304 WP_002892066.1 NZ_CP110160:4146719-4147093 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References