Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4146719..4147338 | Replicon | chromosome |
Accession | NZ_CP110160 | ||
Organism | Klebsiella pneumoniae strain YZ22CS089 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OMD38_RS20725 | Protein ID | WP_002892050.1 |
Coordinates | 4147120..4147338 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OMD38_RS20720 | Protein ID | WP_002892066.1 |
Coordinates | 4146719..4147093 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD38_RS20710 (4141871) | 4141871..4143064 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OMD38_RS20715 (4143087) | 4143087..4146233 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OMD38_RS20720 (4146719) | 4146719..4147093 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OMD38_RS20725 (4147120) | 4147120..4147338 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OMD38_RS20730 (4147497) | 4147497..4148063 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OMD38_RS20735 (4148035) | 4148035..4148175 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OMD38_RS20740 (4148196) | 4148196..4148666 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OMD38_RS20745 (4148641) | 4148641..4150092 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OMD38_RS20750 (4150193) | 4150193..4150891 | + | 699 | WP_002892021.1 | GNAT family protein | - |
OMD38_RS20755 (4150888) | 4150888..4151028 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OMD38_RS20760 (4151028) | 4151028..4151291 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263304 WP_002892050.1 NZ_CP110160:4147120-4147338 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT263304 WP_002892066.1 NZ_CP110160:4146719-4147093 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |