Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 704815..705494 | Replicon | chromosome |
Accession | NZ_CP110160 | ||
Organism | Klebsiella pneumoniae strain YZ22CS089 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
Locus tag | OMD38_RS03490 | Protein ID | WP_020324801.1 |
Coordinates | 705153..705494 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A0C7KEL2 |
Locus tag | OMD38_RS03485 | Protein ID | WP_020324792.1 |
Coordinates | 704815..705132 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD38_RS03460 (700029) | 700029..703181 | + | 3153 | WP_022631414.1 | AIDA repeat-containing protein | - |
OMD38_RS03465 (703274) | 703274..703513 | + | 240 | WP_020324820.1 | DUF905 domain-containing protein | - |
OMD38_RS03470 (703616) | 703616..704074 | + | 459 | WP_020324813.1 | antirestriction protein | - |
OMD38_RS03475 (704090) | 704090..704566 | + | 477 | WP_020324797.1 | RadC family protein | - |
OMD38_RS03480 (704575) | 704575..704802 | + | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
OMD38_RS03485 (704815) | 704815..705132 | + | 318 | WP_020324792.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OMD38_RS03490 (705153) | 705153..705494 | + | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
OMD38_RS03495 (705610) | 705610..706443 | + | 834 | WP_020324805.1 | DUF4942 domain-containing protein | - |
OMD38_RS03505 (706746) | 706746..707252 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
OMD38_RS03510 (707352) | 707352..709193 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimA / fimI / fimC / fimD / fimD / fimF / fimG | 658028..706443 | 48415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T263296 WP_020324801.1 NZ_CP110160:705153-705494 [Klebsiella pneumoniae]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7K7A4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7KEL2 |