Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6021..6664 Replicon plasmid unnamed2
Accession NZ_CP110155
Organism Klebsiella pneumoniae strain YZ22CS088

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag OMD36_RS28150 Protein ID WP_000754566.1
Coordinates 6021..6437 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag OMD36_RS28155 Protein ID WP_001261276.1
Coordinates 6434..6664 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD36_RS28120 1888..2295 + 408 WP_074428709.1 recombinase family protein -
OMD36_RS28125 2186..2890 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
OMD36_RS28130 2953..3303 + 351 Protein_4 tyrosine-type recombinase/integrase -
OMD36_RS28135 3278..3586 - 309 Protein_5 integrase core domain-containing protein -
OMD36_RS28140 3603..4679 - 1077 WP_000227969.1 IS110 family transposase -
OMD36_RS28145 4961..5817 - 857 Protein_7 IS3-like element ISEc15 family transposase -
OMD36_RS28150 6021..6437 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
OMD36_RS28155 6434..6664 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OMD36_RS28160 7238..7588 + 351 WP_000493378.1 hypothetical protein -
OMD36_RS28165 7639..8382 + 744 WP_000129823.1 hypothetical protein -
OMD36_RS28170 8379..9155 + 777 WP_000015958.1 site-specific integrase -
OMD36_RS28175 9213..9470 - 258 WP_000764642.1 hypothetical protein -
OMD36_RS28180 9599..9703 - 105 WP_032409716.1 hypothetical protein -
OMD36_RS28185 10233..11099 + 867 WP_004118283.1 replication initiation protein -
OMD36_RS28190 11276..11545 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / blaCTX-M-27 / sul1 / qnrB52 / qacE / aadA16 / dfrA27 / ARR-3 - 1..60163 60163
- inside Integron dfrA27 / aac(6')-Ib-cr / aadA16 / qacE / ARR-3 - 2..60161 60159


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T263293 WP_000754566.1 NZ_CP110155:c6437-6021 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT263293 WP_001261276.1 NZ_CP110155:c6664-6434 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References