Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 132801..133552 | Replicon | plasmid unnamed1 |
Accession | NZ_CP110154 | ||
Organism | Klebsiella pneumoniae strain YZ22CS088 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | OMD36_RS27560 | Protein ID | WP_014386536.1 |
Coordinates | 132801..133283 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | OMD36_RS27565 | Protein ID | WP_004902250.1 |
Coordinates | 133274..133552 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD36_RS27540 | 129200..129847 | - | 648 | WP_014386537.1 | EcsC family protein | - |
OMD36_RS27545 | 129874..130629 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
OMD36_RS27550 | 130730..131122 | - | 393 | WP_032442757.1 | hypothetical protein | - |
OMD36_RS27555 | 131227..131766 | - | 540 | WP_004902239.1 | hypothetical protein | - |
OMD36_RS27560 | 132801..133283 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
OMD36_RS27565 | 133274..133552 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
OMD36_RS27570 | 133671..133883 | - | 213 | WP_004902255.1 | hypothetical protein | - |
OMD36_RS27575 | 133991..134332 | - | 342 | WP_004902257.1 | hypothetical protein | - |
OMD36_RS27580 | 135162..135620 | - | 459 | WP_014386535.1 | hypothetical protein | - |
OMD36_RS27585 | 136874..137758 | + | 885 | WP_004186900.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 | - | 1..239545 | 239545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T263292 WP_014386536.1 NZ_CP110154:c133283-132801 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |