Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 87438..88081 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP110154 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS088 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OMD36_RS27325 | Protein ID | WP_285806461.1 |
| Coordinates | 87438..87854 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | OMD36_RS27330 | Protein ID | WP_001261276.1 |
| Coordinates | 87851..88081 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD36_RS27305 | 83455..83676 | - | 222 | Protein_86 | GNAT family N-acetyltransferase | - |
| OMD36_RS27310 | 83710..84678 | + | 969 | WP_013815099.1 | IS5-like element IS903B family transposase | - |
| OMD36_RS27315 | 84773..85447 | + | 675 | WP_285806459.1 | fimbrial protein | - |
| OMD36_RS27325 | 87438..87854 | - | 417 | WP_285806461.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OMD36_RS27330 | 87851..88081 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OMD36_RS27335 | 88334..90910 | - | 2577 | WP_285806462.1 | nuclease domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 | - | 1..239545 | 239545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15049.55 Da Isoelectric Point: 9.2957
>T263291 WP_285806461.1 NZ_CP110154:c87854-87438 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTAIRIAQRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTAIRIAQRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|