Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4148746..4149365 | Replicon | chromosome |
Accession | NZ_CP110153 | ||
Organism | Klebsiella pneumoniae strain YZ22CS088 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OMD36_RS20725 | Protein ID | WP_002892050.1 |
Coordinates | 4149147..4149365 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OMD36_RS20720 | Protein ID | WP_002892066.1 |
Coordinates | 4148746..4149120 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD36_RS20710 (4143898) | 4143898..4145091 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OMD36_RS20715 (4145114) | 4145114..4148260 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OMD36_RS20720 (4148746) | 4148746..4149120 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OMD36_RS20725 (4149147) | 4149147..4149365 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OMD36_RS20730 (4149524) | 4149524..4150090 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OMD36_RS20735 (4150062) | 4150062..4150202 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OMD36_RS20740 (4150223) | 4150223..4150693 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OMD36_RS20745 (4150668) | 4150668..4152119 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OMD36_RS20750 (4152220) | 4152220..4152918 | + | 699 | WP_002892021.1 | GNAT family protein | - |
OMD36_RS20755 (4152915) | 4152915..4153055 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OMD36_RS20760 (4153055) | 4153055..4153318 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263284 WP_002892050.1 NZ_CP110153:4149147-4149365 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT263284 WP_002892066.1 NZ_CP110153:4148746-4149120 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |