Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4148746..4149365 Replicon chromosome
Accession NZ_CP110153
Organism Klebsiella pneumoniae strain YZ22CS088

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OMD36_RS20725 Protein ID WP_002892050.1
Coordinates 4149147..4149365 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OMD36_RS20720 Protein ID WP_002892066.1
Coordinates 4148746..4149120 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD36_RS20710 (4143898) 4143898..4145091 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OMD36_RS20715 (4145114) 4145114..4148260 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OMD36_RS20720 (4148746) 4148746..4149120 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OMD36_RS20725 (4149147) 4149147..4149365 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OMD36_RS20730 (4149524) 4149524..4150090 + 567 WP_002892030.1 maltose O-acetyltransferase -
OMD36_RS20735 (4150062) 4150062..4150202 - 141 WP_004147370.1 hypothetical protein -
OMD36_RS20740 (4150223) 4150223..4150693 + 471 WP_002892026.1 YlaC family protein -
OMD36_RS20745 (4150668) 4150668..4152119 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OMD36_RS20750 (4152220) 4152220..4152918 + 699 WP_002892021.1 GNAT family protein -
OMD36_RS20755 (4152915) 4152915..4153055 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OMD36_RS20760 (4153055) 4153055..4153318 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263284 WP_002892050.1 NZ_CP110153:4149147-4149365 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263284 WP_002892066.1 NZ_CP110153:4148746-4149120 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References