Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5122987..5123612 | Replicon | chromosome |
| Accession | NZ_CP110150 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS072 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A483GDF6 |
| Locus tag | OK018_RS24950 | Protein ID | WP_004187928.1 |
| Coordinates | 5122987..5123370 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | OK018_RS24955 | Protein ID | WP_004150355.1 |
| Coordinates | 5123370..5123612 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK018_RS24935 (5120353) | 5120353..5121255 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| OK018_RS24940 (5121252) | 5121252..5121887 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OK018_RS24945 (5121884) | 5121884..5122813 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| OK018_RS24950 (5122987) | 5122987..5123370 | - | 384 | WP_004187928.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OK018_RS24955 (5123370) | 5123370..5123612 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| OK018_RS24960 (5123806) | 5123806..5124723 | + | 918 | WP_032437488.1 | alpha/beta hydrolase | - |
| OK018_RS24965 (5124737) | 5124737..5125678 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| OK018_RS24970 (5125723) | 5125723..5126160 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| OK018_RS24975 (5126157) | 5126157..5127017 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| OK018_RS24980 (5127011) | 5127011..5127610 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14407.64 Da Isoelectric Point: 7.3178
>T263271 WP_004187928.1 NZ_CP110150:c5123370-5122987 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GDF6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |