Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4548628..4549354 | Replicon | chromosome |
Accession | NZ_CP110150 | ||
Organism | Klebsiella pneumoniae strain YZ22CS072 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | OK018_RS22270 | Protein ID | WP_032437356.1 |
Coordinates | 4548628..4548969 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | OK018_RS22275 | Protein ID | WP_032437354.1 |
Coordinates | 4549004..4549354 (-) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK018_RS22240 (4543635) | 4543635..4544906 | + | 1272 | Protein_4358 | conjugative transfer system coupling protein TraD | - |
OK018_RS22245 (4544869) | 4544869..4545135 | + | 267 | WP_004178415.1 | hypothetical protein | - |
OK018_RS22250 (4545135) | 4545135..4545807 | + | 673 | Protein_4360 | DUF4400 domain-containing protein | - |
OK018_RS22255 (4545818) | 4545818..4546702 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
OK018_RS22260 (4546901) | 4546901..4547089 | - | 189 | Protein_4362 | transposase | - |
OK018_RS22265 (4547106) | 4547106..4548217 | - | 1112 | Protein_4363 | IS3 family transposase | - |
OK018_RS22270 (4548628) | 4548628..4548969 | - | 342 | WP_032437356.1 | TA system toxin CbtA family protein | Toxin |
OK018_RS22275 (4549004) | 4549004..4549354 | - | 351 | WP_032437354.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OK018_RS22280 (4549375) | 4549375..4549596 | - | 222 | WP_063931680.1 | DUF987 domain-containing protein | - |
OK018_RS22285 (4549612) | 4549612..4550085 | - | 474 | WP_032437352.1 | DNA repair protein RadC | - |
OK018_RS22290 (4550156) | 4550156..4550977 | - | 822 | WP_032437350.1 | DUF932 domain-containing protein | - |
OK018_RS22295 (4551073) | 4551073..4551750 | - | 678 | WP_032437348.1 | hypothetical protein | - |
OK018_RS22300 (4552036) | 4552036..4552929 | - | 894 | WP_032437346.1 | 50S ribosome-binding GTPase | - |
OK018_RS22305 (4553027) | 4553027..4554178 | + | 1152 | WP_129075233.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4537915..4577031 | 39116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12991.04 Da Isoelectric Point: 5.0978
>T263268 WP_032437356.1 NZ_CP110150:c4548969-4548628 [Klebsiella pneumoniae]
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
Download Length: 342 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12859.60 Da Isoelectric Point: 6.3108
>AT263268 WP_032437354.1 NZ_CP110150:c4549354-4549004 [Klebsiella pneumoniae]
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|