Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4508987..4509797 | Replicon | chromosome |
Accession | NZ_CP110150 | ||
Organism | Klebsiella pneumoniae strain YZ22CS072 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A483G813 |
Locus tag | OK018_RS22045 | Protein ID | WP_023279404.1 |
Coordinates | 4508987..4509520 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | OK018_RS22050 | Protein ID | WP_002887278.1 |
Coordinates | 4509531..4509797 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK018_RS22040 (4507818) | 4507818..4508939 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
OK018_RS22045 (4508987) | 4508987..4509520 | - | 534 | WP_023279404.1 | type II toxin-antitoxin system toxin KacT | Toxin |
OK018_RS22050 (4509531) | 4509531..4509797 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
OK018_RS22055 (4509900) | 4509900..4511333 | - | 1434 | WP_004192214.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
OK018_RS22060 (4511323) | 4511323..4512006 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
OK018_RS22065 (4512178) | 4512178..4513563 | + | 1386 | WP_004192218.1 | efflux transporter outer membrane subunit | - |
OK018_RS22070 (4513581) | 4513581..4513925 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19809.71 Da Isoelectric Point: 6.2369
>T263267 WP_023279404.1 NZ_CP110150:c4509520-4508987 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483G813 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |