Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 288407..288929 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP110149 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS023 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | OMA13_RS27215 | Protein ID | WP_004181778.1 |
| Coordinates | 288645..288929 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | OMA13_RS27210 | Protein ID | WP_004181777.1 |
| Coordinates | 288407..288655 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMA13_RS27190 | 283616..284437 | - | 822 | WP_004181772.1 | hypothetical protein | - |
| OMA13_RS27195 | 284499..284852 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| OMA13_RS27200 | 284997..285983 | - | 987 | WP_094965947.1 | hypothetical protein | - |
| OMA13_RS27205 | 286317..288116 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
| OMA13_RS27210 | 288407..288655 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OMA13_RS27215 | 288645..288929 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OMA13_RS27220 | 288946..289047 | - | 102 | Protein_326 | IS200/IS605 family transposase | - |
| OMA13_RS27225 | 289083..290309 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
| OMA13_RS27230 | 290580..290804 | - | 225 | Protein_328 | transposase | - |
| OMA13_RS27235 | 290883..291311 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
| OMA13_RS27240 | 291347..292534 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
| OMA13_RS27245 | 292579..292950 | - | 372 | WP_040209644.1 | hypothetical protein | - |
| OMA13_RS27250 | 292947..293291 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / floR / aac(3)-IId / tet(D) / blaCTX-M-27 / qnrB52 / blaDHA-1 / qnrB4 | - | 1..368144 | 368144 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T263256 WP_004181778.1 NZ_CP110149:288645-288929 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |