Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 224517..225160 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP110149 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS023 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OMA13_RS26810 | Protein ID | WP_016236302.1 |
| Coordinates | 224744..225160 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OMA13_RS26805 | Protein ID | WP_001261282.1 |
| Coordinates | 224517..224747 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMA13_RS26770 | 220089..220955 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| OMA13_RS26775 | 221490..221594 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| OMA13_RS26780 | 221723..221980 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| OMA13_RS26785 | 222038..222814 | - | 777 | WP_000015958.1 | site-specific integrase | - |
| OMA13_RS26790 | 222811..223554 | - | 744 | WP_000129823.1 | hypothetical protein | - |
| OMA13_RS26795 | 223605..223955 | - | 351 | WP_000493378.1 | hypothetical protein | - |
| OMA13_RS26800 | 224099..224560 | - | 462 | WP_248079180.1 | hypothetical protein | - |
| OMA13_RS26805 | 224517..224747 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OMA13_RS26810 | 224744..225160 | + | 417 | WP_016236302.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OMA13_RS26815 | 225234..225452 | + | 219 | Protein_245 | AAA family ATPase | - |
| OMA13_RS26820 | 225517..226221 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OMA13_RS26825 | 226973..227359 | + | 387 | WP_001039463.1 | plasmid stabilization protein StbA | - |
| OMA13_RS26830 | 227368..227559 | + | 192 | WP_000861580.1 | hypothetical protein | - |
| OMA13_RS26835 | 227570..228037 | - | 468 | Protein_249 | IS1 family transposase | - |
| OMA13_RS26840 | 228571..229326 | + | 756 | WP_000807690.1 | replication initiation protein RepE | - |
| OMA13_RS26845 | 229595..229939 | + | 345 | Protein_251 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / floR / aac(3)-IId / tet(D) / blaCTX-M-27 / qnrB52 / blaDHA-1 / qnrB4 | - | 1..368144 | 368144 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15091.55 Da Isoelectric Point: 7.1084
>T263255 WP_016236302.1 NZ_CP110149:224744-225160 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|