263255

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 224517..225160 Replicon plasmid unnamed1
Accession NZ_CP110149
Organism Klebsiella pneumoniae strain YZ22CS023

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OMA13_RS26810 Protein ID WP_016236302.1
Coordinates 224744..225160 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OMA13_RS26805 Protein ID WP_001261282.1
Coordinates 224517..224747 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMA13_RS26770 220089..220955 - 867 WP_004118283.1 replication initiation protein -
OMA13_RS26775 221490..221594 + 105 WP_032409716.1 hypothetical protein -
OMA13_RS26780 221723..221980 + 258 WP_000764642.1 hypothetical protein -
OMA13_RS26785 222038..222814 - 777 WP_000015958.1 site-specific integrase -
OMA13_RS26790 222811..223554 - 744 WP_000129823.1 hypothetical protein -
OMA13_RS26795 223605..223955 - 351 WP_000493378.1 hypothetical protein -
OMA13_RS26800 224099..224560 - 462 WP_248079180.1 hypothetical protein -
OMA13_RS26805 224517..224747 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OMA13_RS26810 224744..225160 + 417 WP_016236302.1 type II toxin-antitoxin system VapC family toxin Toxin
OMA13_RS26815 225234..225452 + 219 Protein_245 AAA family ATPase -
OMA13_RS26820 225517..226221 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
OMA13_RS26825 226973..227359 + 387 WP_001039463.1 plasmid stabilization protein StbA -
OMA13_RS26830 227368..227559 + 192 WP_000861580.1 hypothetical protein -
OMA13_RS26835 227570..228037 - 468 Protein_249 IS1 family transposase -
OMA13_RS26840 228571..229326 + 756 WP_000807690.1 replication initiation protein RepE -
OMA13_RS26845 229595..229939 + 345 Protein_251 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / floR / aac(3)-IId / tet(D) / blaCTX-M-27 / qnrB52 / blaDHA-1 / qnrB4 - 1..368144 368144


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15091.55 Da        Isoelectric Point: 7.1084

>T263255 WP_016236302.1 NZ_CP110149:224744-225160 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT263255 WP_001261282.1 NZ_CP110149:224517-224747 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References