Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 57958..58868 Replicon plasmid unnamed1
Accession NZ_CP110149
Organism Klebsiella pneumoniae strain YZ22CS023

Toxin (Protein)


Gene name - Uniprot ID A0A5Q9LR54
Locus tag OMA13_RS25930 Protein ID WP_004181896.1
Coordinates 58398..58868 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A2J4RLY9
Locus tag OMA13_RS25925 Protein ID WP_004181895.1
Coordinates 57958..58401 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMA13_RS25900 53113..53328 - 216 Protein_62 IS200/IS605 family transposase -
OMA13_RS25905 53330..53899 + 570 Protein_63 transposase -
OMA13_RS25910 54591..56078 + 1488 WP_004178082.1 group II intron reverse transcriptase/maturase -
OMA13_RS25915 56164..56586 + 423 WP_004181893.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
OMA13_RS25920 56586..57857 + 1272 WP_004181894.1 translesion error-prone DNA polymerase V subunit UmuC -
OMA13_RS25925 57958..58401 + 444 WP_004181895.1 DUF2384 domain-containing protein Antitoxin
OMA13_RS25930 58398..58868 + 471 WP_004181896.1 RES family NAD+ phosphorylase Toxin
OMA13_RS25935 58978..59238 - 261 WP_004026352.1 hypothetical protein -
OMA13_RS25940 59961..60119 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
OMA13_RS25945 60722..61696 + 975 WP_040222313.1 hypothetical protein -
OMA13_RS25950 61894..62271 - 378 WP_004181901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / floR / aac(3)-IId / tet(D) / blaCTX-M-27 / qnrB52 / blaDHA-1 / qnrB4 - 1..368144 368144


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17549.81 Da        Isoelectric Point: 4.6155

>T263254 WP_004181896.1 NZ_CP110149:58398-58868 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16536.87 Da        Isoelectric Point: 10.3013

>AT263254 WP_004181895.1 NZ_CP110149:57958-58401 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LR54

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4RLY9

References