Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5187668..5188293 | Replicon | chromosome |
Accession | NZ_CP110148 | ||
Organism | Klebsiella pneumoniae strain YZ22CS023 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | OMA13_RS25205 | Protein ID | WP_002882817.1 |
Coordinates | 5187668..5188051 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | OMA13_RS25210 | Protein ID | WP_004150355.1 |
Coordinates | 5188051..5188293 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMA13_RS25190 (5185034) | 5185034..5185936 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
OMA13_RS25195 (5185933) | 5185933..5186568 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
OMA13_RS25200 (5186565) | 5186565..5187494 | + | 930 | WP_115701461.1 | formate dehydrogenase accessory protein FdhE | - |
OMA13_RS25205 (5187668) | 5187668..5188051 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OMA13_RS25210 (5188051) | 5188051..5188293 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
OMA13_RS25215 (5188498) | 5188498..5189415 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
OMA13_RS25220 (5189429) | 5189429..5190370 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
OMA13_RS25225 (5190415) | 5190415..5190852 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
OMA13_RS25230 (5190849) | 5190849..5191709 | - | 861 | WP_115701464.1 | virulence factor BrkB family protein | - |
OMA13_RS25235 (5191703) | 5191703..5192302 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T263253 WP_002882817.1 NZ_CP110148:c5188051-5187668 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |