Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4694579..4695095 | Replicon | chromosome |
Accession | NZ_CP110148 | ||
Organism | Klebsiella pneumoniae strain YZ22CS023 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | OMA13_RS22850 | Protein ID | WP_009486548.1 |
Coordinates | 4694579..4694863 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OMA13_RS22855 | Protein ID | WP_002886901.1 |
Coordinates | 4694853..4695095 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMA13_RS22825 (4689996) | 4689996..4690259 | - | 264 | WP_031280360.1 | PTS sugar transporter subunit IIB | - |
OMA13_RS22830 (4690389) | 4690389..4690562 | + | 174 | WP_032408826.1 | hypothetical protein | - |
OMA13_RS22835 (4690565) | 4690565..4691308 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OMA13_RS22840 (4691665) | 4691665..4693803 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OMA13_RS22845 (4694111) | 4694111..4694575 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OMA13_RS22850 (4694579) | 4694579..4694863 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMA13_RS22855 (4694853) | 4694853..4695095 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OMA13_RS22860 (4695173) | 4695173..4697083 | - | 1911 | WP_031593171.1 | PRD domain-containing protein | - |
OMA13_RS22865 (4697106) | 4697106..4698260 | - | 1155 | WP_115701375.1 | lactonase family protein | - |
OMA13_RS22870 (4698327) | 4698327..4699067 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T263251 WP_009486548.1 NZ_CP110148:c4694863-4694579 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |