Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3980789..3981408 Replicon chromosome
Accession NZ_CP110148
Organism Klebsiella pneumoniae strain YZ22CS023

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OMA13_RS19485 Protein ID WP_002892050.1
Coordinates 3981190..3981408 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OMA13_RS19480 Protein ID WP_002892066.1
Coordinates 3980789..3981163 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMA13_RS19470 (3975941) 3975941..3977134 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OMA13_RS19475 (3977157) 3977157..3980303 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OMA13_RS19480 (3980789) 3980789..3981163 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OMA13_RS19485 (3981190) 3981190..3981408 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OMA13_RS19490 (3981567) 3981567..3982133 + 567 WP_002892030.1 maltose O-acetyltransferase -
OMA13_RS19495 (3982105) 3982105..3982245 - 141 WP_004147370.1 hypothetical protein -
OMA13_RS19500 (3982266) 3982266..3982736 + 471 WP_002892026.1 YlaC family protein -
OMA13_RS19505 (3982711) 3982711..3984162 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OMA13_RS19510 (3984263) 3984263..3984961 + 699 WP_002892021.1 GNAT family protein -
OMA13_RS19515 (3984958) 3984958..3985098 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OMA13_RS19520 (3985098) 3985098..3985361 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263249 WP_002892050.1 NZ_CP110148:3981190-3981408 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263249 WP_002892066.1 NZ_CP110148:3980789-3981163 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References