Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3980789..3981408 | Replicon | chromosome |
| Accession | NZ_CP110148 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS023 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OMA13_RS19485 | Protein ID | WP_002892050.1 |
| Coordinates | 3981190..3981408 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | OMA13_RS19480 | Protein ID | WP_002892066.1 |
| Coordinates | 3980789..3981163 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMA13_RS19470 (3975941) | 3975941..3977134 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OMA13_RS19475 (3977157) | 3977157..3980303 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OMA13_RS19480 (3980789) | 3980789..3981163 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| OMA13_RS19485 (3981190) | 3981190..3981408 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OMA13_RS19490 (3981567) | 3981567..3982133 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| OMA13_RS19495 (3982105) | 3982105..3982245 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| OMA13_RS19500 (3982266) | 3982266..3982736 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| OMA13_RS19505 (3982711) | 3982711..3984162 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| OMA13_RS19510 (3984263) | 3984263..3984961 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| OMA13_RS19515 (3984958) | 3984958..3985098 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OMA13_RS19520 (3985098) | 3985098..3985361 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263249 WP_002892050.1 NZ_CP110148:3981190-3981408 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT263249 WP_002892066.1 NZ_CP110148:3980789-3981163 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |