Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 21558..22201 | Replicon | plasmid unnamed2 |
Accession | NZ_CP110147 | ||
Organism | Klebsiella pneumoniae strain YZ22CK024 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A155IU92 |
Locus tag | OMD35_RS27460 | Protein ID | WP_000754567.1 |
Coordinates | 21785..22201 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A853H7M9 |
Locus tag | OMD35_RS27455 | Protein ID | WP_001261275.1 |
Coordinates | 21558..21788 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD35_RS27450 | 18729..21305 | + | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
OMD35_RS27455 | 21558..21788 | + | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OMD35_RS27460 | 21785..22201 | + | 417 | WP_000754567.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OMD35_RS27465 | 22382..23401 | - | 1020 | WP_064160291.1 | fimbrial protein | - |
OMD35_RS27470 | 23422..25815 | - | 2394 | WP_064163930.1 | fimbria/pilus outer membrane usher protein | - |
OMD35_RS27475 | 25827..26522 | - | 696 | WP_064160295.1 | molecular chaperone | - |
OMD35_RS27480 | 26581..27150 | - | 570 | WP_064160296.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sul1 / qacE / aadA2 / dfrA12 / qnrS1 / blaLAP-2 / sul2 / aph(3')-Ia / mph(A) | pla | 1..216138 | 216138 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15108.61 Da Isoelectric Point: 8.5403
>T263238 WP_000754567.1 NZ_CP110147:21785-22201 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A155IU92 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A853H7M9 |