Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4189839..4190518 Replicon chromosome
Accession NZ_CP110145
Organism Klebsiella pneumoniae strain YZ22CK024

Toxin (Protein)


Gene name ykfI Uniprot ID A0A8T3UN62
Locus tag OMD35_RS20565 Protein ID WP_038879470.1
Coordinates 4189839..4190180 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag OMD35_RS20570 Protein ID WP_114263039.1
Coordinates 4190201..4190518 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD35_RS20535 4184858..4185124 + 267 WP_004178415.1 hypothetical protein -
OMD35_RS20540 4185124..4185796 + 673 Protein_4019 DUF4400 domain-containing protein -
OMD35_RS20545 4185807..4186691 + 885 WP_004192285.1 RES domain-containing protein -
OMD35_RS20550 4186890..4187078 - 189 Protein_4021 transposase -
OMD35_RS20555 4187095..4188206 - 1112 Protein_4022 IS3 family transposase -
OMD35_RS20560 4188573..4189580 - 1008 WP_114263038.1 restriction endonuclease -
OMD35_RS20565 4189839..4190180 - 342 WP_038879470.1 TA system toxin CbtA family protein Toxin
OMD35_RS20570 4190201..4190518 - 318 WP_114263039.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OMD35_RS20575 4190537..4190758 - 222 WP_114263040.1 DUF987 domain-containing protein -
OMD35_RS20580 4190767..4191243 - 477 WP_114263041.1 RadC family protein -
OMD35_RS20585 4191259..4191717 - 459 WP_114263042.1 antirestriction protein -
OMD35_RS20590 4191803..4192039 - 237 WP_050150430.1 DUF905 domain-containing protein -
OMD35_RS20595 4192117..4192527 - 411 WP_114263043.1 hypothetical protein -
OMD35_RS20600 4192594..4193031 - 438 WP_023301392.1 hypothetical protein -
OMD35_RS20605 4193073..4193609 - 537 WP_114263044.1 DUF4339 domain-containing protein -
OMD35_RS20610 4193635..4194345 - 711 WP_114263045.1 DeoR family transcriptional regulator -
OMD35_RS20615 4194554..4195378 - 825 WP_114263046.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4170771..4221297 50526


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12720.66 Da        Isoelectric Point: 8.0324

>T263231 WP_038879470.1 NZ_CP110145:c4190180-4189839 [Klebsiella pneumoniae]
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11770.44 Da        Isoelectric Point: 6.9365

>AT263231 WP_114263039.1 NZ_CP110145:c4190518-4190201 [Klebsiella pneumoniae]
MSNITWGLQRNITPRLGACLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRHAHCVTLYH
NGFTCEADTLGSCGYVYIAVYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References