Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3543634..3544253 Replicon chromosome
Accession NZ_CP110145
Organism Klebsiella pneumoniae strain YZ22CK024

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OMD35_RS17460 Protein ID WP_002892050.1
Coordinates 3544035..3544253 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OMD35_RS17455 Protein ID WP_002892066.1
Coordinates 3543634..3544008 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD35_RS17445 3538786..3539979 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OMD35_RS17450 3540002..3543148 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OMD35_RS17455 3543634..3544008 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OMD35_RS17460 3544035..3544253 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OMD35_RS17465 3544416..3544982 + 567 WP_002892030.1 maltose O-acetyltransferase -
OMD35_RS17470 3544954..3545094 - 141 WP_004147370.1 hypothetical protein -
OMD35_RS17475 3545115..3545585 + 471 WP_020802585.1 YlaC family protein -
OMD35_RS17480 3545560..3547011 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
OMD35_RS17485 3547112..3547810 + 699 WP_023287311.1 GNAT family protein -
OMD35_RS17490 3547807..3547947 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OMD35_RS17495 3547947..3548210 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263229 WP_002892050.1 NZ_CP110145:3544035-3544253 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263229 WP_002892066.1 NZ_CP110145:3543634-3544008 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References