Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1031388..1032124 | Replicon | chromosome |
Accession | NZ_CP110145 | ||
Organism | Klebsiella pneumoniae strain YZ22CK024 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | OMD35_RS05120 | Protein ID | WP_032433360.1 |
Coordinates | 1031642..1032124 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OMD35_RS05115 | Protein ID | WP_003026799.1 |
Coordinates | 1031388..1031654 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD35_RS05090 | 1027034..1028173 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
OMD35_RS05095 | 1028202..1028864 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
OMD35_RS05100 | 1028845..1029852 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
OMD35_RS05105 | 1029870..1030502 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
OMD35_RS05110 | 1030512..1031075 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
OMD35_RS05115 | 1031388..1031654 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OMD35_RS05120 | 1031642..1032124 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
OMD35_RS05125 | 1032485..1033084 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
OMD35_RS05130 | 1033297..1034241 | - | 945 | WP_077254249.1 | fimbrial protein | - |
OMD35_RS05135 | 1034253..1034831 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
OMD35_RS05140 | 1034835..1035575 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 999333..1043067 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T263223 WP_032433360.1 NZ_CP110145:1031642-1032124 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |