Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1014697..1015340 | Replicon | chromosome |
| Accession | NZ_CP110145 | ||
| Organism | Klebsiella pneumoniae strain YZ22CK024 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | OMD35_RS05025 | Protein ID | WP_032433387.1 |
| Coordinates | 1014924..1015340 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | OMD35_RS05020 | Protein ID | WP_001261276.1 |
| Coordinates | 1014697..1014927 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD35_RS05005 | 1009719..1010806 | + | 1088 | Protein_969 | transcriptional repressor PifC | - |
| OMD35_RS05010 | 1010809..1013049 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| OMD35_RS05015 | 1013577..1014392 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| OMD35_RS05020 | 1014697..1014927 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OMD35_RS05025 | 1014924..1015340 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OMD35_RS05030 | 1015496..1016476 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| OMD35_RS05035 | 1016671..1018242 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| OMD35_RS05040 | 1018561..1018809 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| OMD35_RS05045 | 1018868..1019386 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| OMD35_RS05050 | 1019417..1019908 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| OMD35_RS05055 | 1019968..1020171 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 999333..1043067 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T263222 WP_032433387.1 NZ_CP110145:1014924-1015340 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |