Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 53674..54410 | Replicon | plasmid unnamed2 |
Accession | NZ_CP110144 | ||
Organism | Klebsiella pneumoniae strain SBH193 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OMD37_RS28955 | Protein ID | WP_003026803.1 |
Coordinates | 53928..54410 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OMD37_RS28950 | Protein ID | WP_003026799.1 |
Coordinates | 53674..53940 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD37_RS28905 | 49736..50098 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
OMD37_RS28910 | 50148..50498 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
OMD37_RS28915 | 50856..51125 | + | 270 | WP_004152102.1 | hypothetical protein | - |
OMD37_RS28920 | 51113..51688 | + | 576 | WP_004152103.1 | hypothetical protein | - |
OMD37_RS28925 | 51719..52213 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
OMD37_RS28930 | 52257..52625 | + | 369 | WP_004152105.1 | hypothetical protein | - |
OMD37_RS28935 | 52659..52862 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
OMD37_RS28940 | 52911..53168 | + | 258 | WP_004152107.1 | hypothetical protein | - |
OMD37_RS28945 | 53244..53498 | + | 255 | WP_004152108.1 | hypothetical protein | - |
OMD37_RS28950 | 53674..53940 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OMD37_RS28955 | 53928..54410 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OMD37_RS28960 | 54618..55964 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
OMD37_RS28965 | 56013..56408 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
OMD37_RS28970 | 56555..57720 | - | 1166 | Protein_59 | IS3 family transposase | - |
OMD37_RS28975 | 57897..58859 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
OMD37_RS28980 | 58846..59334 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-3 / dfrA14 / aac(3)-IIa / aac(6')-Ib-cr / blaOXA-1 / tet(A) / qnrB1 | - | 1..238814 | 238814 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T263219 WP_003026803.1 NZ_CP110144:53928-54410 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |