Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 266360..266882 | Replicon | plasmid unnamed1 |
Accession | NZ_CP110143 | ||
Organism | Klebsiella pneumoniae strain SBH193 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A0C7KG00 |
Locus tag | OMD37_RS28305 | Protein ID | WP_038991638.1 |
Coordinates | 266598..266882 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | OMD37_RS28300 | Protein ID | WP_004181777.1 |
Coordinates | 266360..266608 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD37_RS28280 | 261569..262405 | - | 837 | WP_014386523.1 | hypothetical protein | - |
OMD37_RS28285 | 262452..262805 | - | 354 | WP_004181774.1 | hypothetical protein | - |
OMD37_RS28290 | 262950..263936 | - | 987 | WP_086528942.1 | hypothetical protein | - |
OMD37_RS28295 | 264270..266069 | - | 1800 | WP_038991636.1 | ATP-dependent helicase | - |
OMD37_RS28300 | 266360..266608 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OMD37_RS28305 | 266598..266882 | + | 285 | WP_038991638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMD37_RS28310 | 267036..268262 | + | 1227 | WP_229544130.1 | transposase | - |
OMD37_RS28315 | 268534..268758 | - | 225 | Protein_297 | transposase | - |
OMD37_RS28320 | 268837..269265 | - | 429 | WP_151373988.1 | IS200/IS605 family transposase | - |
OMD37_RS28325 | 269301..270488 | + | 1188 | WP_094284697.1 | RNA-guided endonuclease TnpB family protein | - |
OMD37_RS28330 | 270533..270904 | - | 372 | WP_227627908.1 | hypothetical protein | - |
OMD37_RS28335 | 270901..271245 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / blaDHA-1 / qnrB4 | - | 1..344396 | 344396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10993.73 Da Isoelectric Point: 10.6516
>T263218 WP_038991638.1 NZ_CP110143:266598-266882 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYHLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYHLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7KG00 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |