Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 162760..163511 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP110143 | ||
| Organism | Klebsiella pneumoniae strain SBH193 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | OMD37_RS27720 | Protein ID | WP_101826042.1 |
| Coordinates | 162760..163242 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A6S4YWG5 |
| Locus tag | OMD37_RS27725 | Protein ID | WP_012540170.1 |
| Coordinates | 163233..163511 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD37_RS27690 | 157875..158569 | - | 695 | Protein_172 | zinc-binding dehydrogenase | - |
| OMD37_RS27695 | 158653..159057 | + | 405 | WP_285808051.1 | transposase | - |
| OMD37_RS27700 | 159054..159401 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| OMD37_RS27705 | 159450..160988 | + | 1539 | WP_285808052.1 | IS66-like element ISKpn24 family transposase | - |
| OMD37_RS27710 | 161148..161981 | - | 834 | WP_012540133.1 | GIY-YIG nuclease family protein | - |
| OMD37_RS27715 | 162318..162722 | - | 405 | WP_048293664.1 | DUF2251 domain-containing protein | - |
| OMD37_RS27720 | 162760..163242 | - | 483 | WP_101826042.1 | GNAT family N-acetyltransferase | Toxin |
| OMD37_RS27725 | 163233..163511 | - | 279 | WP_012540170.1 | DUF1778 domain-containing protein | Antitoxin |
| OMD37_RS27730 | 163819..164355 | + | 537 | WP_285808056.1 | hypothetical protein | - |
| OMD37_RS27735 | 165283..165741 | - | 459 | WP_014386535.1 | hypothetical protein | - |
| OMD37_RS27740 | 166995..167879 | + | 885 | WP_004186900.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / blaDHA-1 / qnrB4 | - | 1..344396 | 344396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17698.59 Da Isoelectric Point: 9.1776
>T263217 WP_101826042.1 NZ_CP110143:c163242-162760 [Klebsiella pneumoniae]
MGMRPPEPLTPEHNIADFCCQDQVLSEWLKKKALKNHSTGLSRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGMRPPEPLTPEHNIADFCCQDQVLSEWLKKKALKNHSTGLSRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|