Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 149617..150368 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP110143 | ||
| Organism | Klebsiella pneumoniae strain SBH193 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A071LQ79 |
| Locus tag | OMD37_RS27650 | Protein ID | WP_036114515.1 |
| Coordinates | 149886..150368 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | OMD37_RS27645 | Protein ID | WP_285808043.1 |
| Coordinates | 149617..149895 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD37_RS27620 | 145560..147149 | - | 1590 | WP_285808037.1 | IS66 family transposase | - |
| OMD37_RS27625 | 147178..147528 | - | 351 | WP_285808039.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| OMD37_RS27630 | 148031..148771 | + | 741 | WP_285808041.1 | 3-methyl-2-oxobutanoate hydroxymethyltransferase | - |
| OMD37_RS27635 | 148858..149175 | + | 318 | WP_285808064.1 | hypothetical protein | - |
| OMD37_RS27640 | 149283..149495 | + | 213 | Protein_162 | hypothetical protein | - |
| OMD37_RS27645 | 149617..149895 | + | 279 | WP_285808043.1 | DUF1778 domain-containing protein | Antitoxin |
| OMD37_RS27650 | 149886..150368 | + | 483 | WP_036114515.1 | GNAT family N-acetyltransferase | Toxin |
| OMD37_RS27660 | 151399..153162 | - | 1764 | WP_101984517.1 | SgrR family transcriptional regulator | - |
| OMD37_RS27665 | 153305..154129 | + | 825 | WP_101984514.1 | shikimate 5-dehydrogenase | - |
| OMD37_RS27670 | 154224..155270 | + | 1047 | Protein_168 | fructose-specific PTS transporter subunit EIIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / blaDHA-1 / qnrB4 | - | 1..344396 | 344396 | |
| - | inside | IScluster/Tn | - | - | 135355..150771 | 15416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17694.45 Da Isoelectric Point: 8.9130
>T263216 WP_036114515.1 NZ_CP110143:149886-150368 [Klebsiella pneumoniae]
MGMRAPESLTSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTSEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|