Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 50831..51741 | Replicon | plasmid unnamed1 |
Accession | NZ_CP110143 | ||
Organism | Klebsiella pneumoniae strain SBH193 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A663AYG0 |
Locus tag | OMD37_RS27155 | Protein ID | WP_004026354.1 |
Coordinates | 51271..51741 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A2J4RLY9 |
Locus tag | OMD37_RS27150 | Protein ID | WP_004181895.1 |
Coordinates | 50831..51274 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD37_RS27120 | 46026..46454 | + | 429 | WP_272734504.1 | glutaredoxin-dependent arsenate reductase | - |
OMD37_RS27125 | 46511..47188 | - | 678 | WP_285808060.1 | arsenical resistance protein ArsH | - |
OMD37_RS27130 | 47230..47565 | - | 336 | WP_115763904.1 | metalloregulator ArsR/SmtB family transcription factor | - |
OMD37_RS27135 | 47914..48363 | + | 450 | WP_272734506.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
OMD37_RS27140 | 48372..49646 | + | 1275 | WP_272734507.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
OMD37_RS27145 | 49672..50730 | + | 1059 | Protein_63 | translesion error-prone DNA polymerase V subunit UmuC | - |
OMD37_RS27150 | 50831..51274 | + | 444 | WP_004181895.1 | DUF2384 domain-containing protein | Antitoxin |
OMD37_RS27155 | 51271..51741 | + | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
OMD37_RS27160 | 52196..52384 | - | 189 | WP_088403065.1 | hypothetical protein | - |
OMD37_RS27165 | 52998..53258 | - | 261 | WP_004026352.1 | hypothetical protein | - |
OMD37_RS27170 | 53972..54130 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
OMD37_RS27175 | 54736..55710 | + | 975 | WP_174232731.1 | Hok/Gef family protein | - |
OMD37_RS27180 | 55694..55816 | + | 123 | WP_254911979.1 | hypothetical protein | - |
OMD37_RS27185 | 55908..56285 | - | 378 | WP_029884711.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / blaDHA-1 / qnrB4 | - | 1..344396 | 344396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T263215 WP_004026354.1 NZ_CP110143:51271-51741 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16536.87 Da Isoelectric Point: 10.3013
>AT263215 WP_004181895.1 NZ_CP110143:50831-51274 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A663AYG0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4RLY9 |