Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5387102..5387727 | Replicon | chromosome |
Accession | NZ_CP110142 | ||
Organism | Klebsiella pneumoniae strain SBH193 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | OMD37_RS26465 | Protein ID | WP_002882817.1 |
Coordinates | 5387102..5387485 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | OMD37_RS26470 | Protein ID | WP_004150355.1 |
Coordinates | 5387485..5387727 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD37_RS26450 (5384468) | 5384468..5385370 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
OMD37_RS26455 (5385367) | 5385367..5386002 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
OMD37_RS26460 (5385999) | 5385999..5386928 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
OMD37_RS26465 (5387102) | 5387102..5387485 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OMD37_RS26470 (5387485) | 5387485..5387727 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
OMD37_RS26475 (5387932) | 5387932..5388849 | + | 918 | WP_009484979.1 | alpha/beta hydrolase | - |
OMD37_RS26480 (5388863) | 5388863..5389804 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
OMD37_RS26485 (5389849) | 5389849..5390286 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
OMD37_RS26490 (5390283) | 5390283..5391143 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
OMD37_RS26495 (5391137) | 5391137..5391736 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T263214 WP_002882817.1 NZ_CP110142:c5387485-5387102 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |