Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4902673..4903189 | Replicon | chromosome |
Accession | NZ_CP110142 | ||
Organism | Klebsiella pneumoniae strain SBH193 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OMD37_RS24155 | Protein ID | WP_004178374.1 |
Coordinates | 4902673..4902957 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | OMD37_RS24160 | Protein ID | WP_032434351.1 |
Coordinates | 4902947..4903189 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD37_RS24130 (4898156) | 4898156..4898419 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
OMD37_RS24135 (4898549) | 4898549..4898722 | + | 174 | WP_032414379.1 | hypothetical protein | - |
OMD37_RS24140 (4898725) | 4898725..4899468 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OMD37_RS24145 (4899825) | 4899825..4901963 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OMD37_RS24150 (4902205) | 4902205..4902669 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OMD37_RS24155 (4902673) | 4902673..4902957 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMD37_RS24160 (4902947) | 4902947..4903189 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OMD37_RS24165 (4903267) | 4903267..4905177 | - | 1911 | Protein_4739 | PRD domain-containing protein | - |
OMD37_RS24170 (4905200) | 4905200..4906354 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
OMD37_RS24175 (4906420) | 4906420..4907160 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T263212 WP_004178374.1 NZ_CP110142:c4902957-4902673 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|