Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4809945..4810648 | Replicon | chromosome |
| Accession | NZ_CP110142 | ||
| Organism | Klebsiella pneumoniae strain SBH193 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | OMD37_RS23760 | Protein ID | WP_071994632.1 |
| Coordinates | 4809945..4810286 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | OMD37_RS23765 | Protein ID | WP_032434296.1 |
| Coordinates | 4810307..4810648 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD37_RS23750 (4806260) | 4806260..4807129 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| OMD37_RS23755 (4807720) | 4807720..4809753 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
| OMD37_RS23760 (4809945) | 4809945..4810286 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| OMD37_RS23765 (4810307) | 4810307..4810648 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OMD37_RS23770 (4810659) | 4810659..4811201 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| OMD37_RS23775 (4811214) | 4811214..4811654 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| OMD37_RS23780 (4811685) | 4811685..4812506 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| OMD37_RS23785 (4812626) | 4812626..4813099 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| OMD37_RS23790 (4813171) | 4813171..4813623 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| OMD37_RS23795 (4813659) | 4813659..4814375 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| OMD37_RS23800 (4814619) | 4814619..4815493 | - | 875 | Protein_4667 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4798242..4843915 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T263211 WP_071994632.1 NZ_CP110142:c4810286-4809945 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|