Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4105745..4106364 Replicon chromosome
Accession NZ_CP110142
Organism Klebsiella pneumoniae strain SBH193

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OMD37_RS20395 Protein ID WP_002892050.1
Coordinates 4106146..4106364 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OMD37_RS20390 Protein ID WP_002892066.1
Coordinates 4105745..4106119 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD37_RS20380 (4100897) 4100897..4102090 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OMD37_RS20385 (4102113) 4102113..4105259 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OMD37_RS20390 (4105745) 4105745..4106119 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OMD37_RS20395 (4106146) 4106146..4106364 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OMD37_RS20400 (4106523) 4106523..4107089 + 567 WP_002892030.1 maltose O-acetyltransferase -
OMD37_RS20405 (4107061) 4107061..4107201 - 141 WP_004147370.1 hypothetical protein -
OMD37_RS20410 (4107222) 4107222..4107692 + 471 WP_002892026.1 YlaC family protein -
OMD37_RS20415 (4107667) 4107667..4109118 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
OMD37_RS20420 (4109219) 4109219..4109917 + 699 WP_032435564.1 GNAT family protein -
OMD37_RS20425 (4109914) 4109914..4110054 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OMD37_RS20430 (4110054) 4110054..4110317 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263208 WP_002892050.1 NZ_CP110142:4106146-4106364 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263208 WP_002892066.1 NZ_CP110142:4105745-4106119 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References