Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4105745..4106364 | Replicon | chromosome |
Accession | NZ_CP110142 | ||
Organism | Klebsiella pneumoniae strain SBH193 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OMD37_RS20395 | Protein ID | WP_002892050.1 |
Coordinates | 4106146..4106364 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OMD37_RS20390 | Protein ID | WP_002892066.1 |
Coordinates | 4105745..4106119 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMD37_RS20380 (4100897) | 4100897..4102090 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OMD37_RS20385 (4102113) | 4102113..4105259 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OMD37_RS20390 (4105745) | 4105745..4106119 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OMD37_RS20395 (4106146) | 4106146..4106364 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OMD37_RS20400 (4106523) | 4106523..4107089 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OMD37_RS20405 (4107061) | 4107061..4107201 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OMD37_RS20410 (4107222) | 4107222..4107692 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OMD37_RS20415 (4107667) | 4107667..4109118 | - | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
OMD37_RS20420 (4109219) | 4109219..4109917 | + | 699 | WP_032435564.1 | GNAT family protein | - |
OMD37_RS20425 (4109914) | 4109914..4110054 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OMD37_RS20430 (4110054) | 4110054..4110317 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263208 WP_002892050.1 NZ_CP110142:4106146-4106364 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT263208 WP_002892066.1 NZ_CP110142:4105745-4106119 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |