Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1264480..1264966 Replicon chromosome
Accession NZ_CP110141
Organism Streptococcus suis strain WUSS030

Toxin (Protein)


Gene name relE Uniprot ID A0A0K2E5U8
Locus tag NOV96_RS06360 Protein ID WP_002935012.1
Coordinates 1264480..1264737 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0K2E5B0
Locus tag NOV96_RS06365 Protein ID WP_002935014.1
Coordinates 1264727..1264966 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV96_RS06340 (NOV96_06340) 1260114..1261184 + 1071 WP_002935006.1 tyrosine recombinase XerS -
NOV96_RS06345 (NOV96_06345) 1261254..1262762 - 1509 WP_240016552.1 phosphomannomutase/phosphoglucomutase -
NOV96_RS06350 (NOV96_06350) 1262838..1263779 - 942 WP_002935009.1 sensor histidine kinase -
NOV96_RS06355 (NOV96_06355) 1263776..1264441 - 666 WP_009909826.1 response regulator transcription factor -
NOV96_RS06360 (NOV96_06360) 1264480..1264737 - 258 WP_002935012.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NOV96_RS06365 (NOV96_06365) 1264727..1264966 - 240 WP_002935014.1 DUF6290 family protein Antitoxin
NOV96_RS06370 (NOV96_06370) 1265058..1267028 - 1971 WP_013730363.1 FtsX-like permease family protein -
NOV96_RS06375 (NOV96_06375) 1267029..1267781 - 753 WP_002935019.1 ABC transporter ATP-binding protein -
NOV96_RS06380 (NOV96_06380) 1267798..1268181 - 384 WP_002935021.1 NisI/SpaI family lantibiotic immunity lipoprotein -
NOV96_RS06385 (NOV96_06385) 1268194..1268334 - 141 WP_002935023.1 hypothetical protein -
NOV96_RS06390 (NOV96_06390) 1268433..1269167 - 735 WP_002935025.1 TraX family protein -
NOV96_RS06395 (NOV96_06395) 1269180..1269317 - 138 WP_240016553.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element erm(B) - 1227000..1341309 114309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-75)

Antitoxin

Protein of unknown function DUF6290

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 9849.52 Da        Isoelectric Point: 10.7134

>T263196 WP_002935012.1 NZ_CP110141:c1264737-1264480 [Streptococcus suis]
MSYKVILSAKAQKQIRKMDKTAASLILRYLYKHIDGCDNPRQYGKALTANRSGQWRYRIGNYRVIVNIEDDKLIVTSIKM
RNGSI

Download         Length: 258 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8924.19 Da        Isoelectric Point: 3.9191

>AT263196 WP_002935014.1 NZ_CP110141:c1264966-1264727 [Streptococcus suis]
MAAITLKVSEQDKLFMQAMAKFEGVSLSELIRTKTLEALEDEYDARVADVAWAEYQADLANRIEPMTLEQMAEELGIEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K2E5U8

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E5B0

References