Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
| Location | 2876168..2876733 | Replicon | chromosome |
| Accession | NZ_CP110139 | ||
| Organism | Hymenobacter sp. YIM 151500-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OIS53_RS12015 | Protein ID | WP_264678812.1 |
| Coordinates | 2876168..2876512 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OIS53_RS12020 | Protein ID | WP_264678813.1 |
| Coordinates | 2876509..2876733 (-) | Length | 75 a.a. |
Genomic Context
Location: 2872005..2873228 (1224 bp)
Type: Others
Protein ID: WP_264678808.1
Type: Others
Protein ID: WP_264678808.1
Location: 2873284..2874615 (1332 bp)
Type: Others
Protein ID: WP_264678809.1
Type: Others
Protein ID: WP_264678809.1
Location: 2874843..2875352 (510 bp)
Type: Others
Protein ID: WP_264678810.1
Type: Others
Protein ID: WP_264678810.1
Location: 2875429..2876145 (717 bp)
Type: Others
Protein ID: WP_264678811.1
Type: Others
Protein ID: WP_264678811.1
Location: 2876168..2876512 (345 bp)
Type: Toxin
Protein ID: WP_264678812.1
Type: Toxin
Protein ID: WP_264678812.1
Location: 2876509..2876733 (225 bp)
Type: Antitoxin
Protein ID: WP_264678813.1
Type: Antitoxin
Protein ID: WP_264678813.1
Location: 2876815..2878515 (1701 bp)
Type: Others
Protein ID: WP_264678814.1
Type: Others
Protein ID: WP_264678814.1
Location: 2878544..2878975 (432 bp)
Type: Others
Protein ID: WP_264678815.1
Type: Others
Protein ID: WP_264678815.1
Location: 2879006..2879164 (159 bp)
Type: Others
Protein ID: WP_264678816.1
Type: Others
Protein ID: WP_264678816.1
Location: 2879335..2879958 (624 bp)
Type: Others
Protein ID: WP_264678817.1
Type: Others
Protein ID: WP_264678817.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIS53_RS11995 (OIS53_11995) | 2872005..2873228 | - | 1224 | WP_264678808.1 | hypothetical protein | - |
| OIS53_RS12000 (OIS53_12000) | 2873284..2874615 | - | 1332 | WP_264678809.1 | amino acid permease | - |
| OIS53_RS12005 (OIS53_12005) | 2874843..2875352 | - | 510 | WP_264678810.1 | DUF2480 family protein | - |
| OIS53_RS12010 (OIS53_12010) | 2875429..2876145 | - | 717 | WP_264678811.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
| OIS53_RS12015 (OIS53_12015) | 2876168..2876512 | - | 345 | WP_264678812.1 | DUF5615 family PIN-like protein | Toxin |
| OIS53_RS12020 (OIS53_12020) | 2876509..2876733 | - | 225 | WP_264678813.1 | DUF433 domain-containing protein | Antitoxin |
| OIS53_RS12025 (OIS53_12025) | 2876815..2878515 | - | 1701 | WP_264678814.1 | S41 family peptidase | - |
| OIS53_RS12030 (OIS53_12030) | 2878544..2878975 | - | 432 | WP_264678815.1 | ribonuclease P protein component | - |
| OIS53_RS12035 (OIS53_12035) | 2879006..2879164 | - | 159 | WP_264678816.1 | 50S ribosomal protein L34 | - |
| OIS53_RS12040 (OIS53_12040) | 2879335..2879958 | - | 624 | WP_264678817.1 | transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12801.01 Da Isoelectric Point: 4.1962
>T263192 WP_264678812.1 NZ_CP110139:c2876512-2876168 [Hymenobacter sp. YIM 151500-1]
MIFWLDAQLSPLLAVWLRWKFKIEALPLRELGLRDAEDEEIFIAAKAAQAIVITKDADFLRLLERLGTPPQIIWLTCGNT
SNERLQQVLVTALPDAIELLNAGEPLVEIGDLLP
MIFWLDAQLSPLLAVWLRWKFKIEALPLRELGLRDAEDEEIFIAAKAAQAIVITKDADFLRLLERLGTPPQIIWLTCGNT
SNERLQQVLVTALPDAIELLNAGEPLVEIGDLLP
Download Length: 345 bp