Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 2657966..2658504 | Replicon | chromosome |
Accession | NZ_CP110136 | ||
Organism | Hymenobacter sp. YIM 151858-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OIS50_RS11830 | Protein ID | WP_264690847.1 |
Coordinates | 2657966..2658283 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OIS50_RS11835 | Protein ID | WP_264690848.1 |
Coordinates | 2658280..2658504 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIS50_RS11805 (OIS50_11805) | 2653794..2654072 | - | 279 | WP_264690842.1 | hypothetical protein | - |
OIS50_RS11810 (OIS50_11810) | 2654047..2655036 | - | 990 | WP_264690843.1 | hypothetical protein | - |
OIS50_RS11815 (OIS50_11815) | 2655133..2656497 | - | 1365 | WP_264690844.1 | amino acid permease | - |
OIS50_RS11820 (OIS50_11820) | 2656646..2657155 | - | 510 | WP_264690845.1 | DUF2480 family protein | - |
OIS50_RS11825 (OIS50_11825) | 2657236..2657931 | - | 696 | WP_264690846.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
OIS50_RS11830 (OIS50_11830) | 2657966..2658283 | - | 318 | WP_264690847.1 | DUF5615 family PIN-like protein | Toxin |
OIS50_RS11835 (OIS50_11835) | 2658280..2658504 | - | 225 | WP_264690848.1 | DUF433 domain-containing protein | Antitoxin |
OIS50_RS11840 (OIS50_11840) | 2658765..2660465 | - | 1701 | WP_264690849.1 | S41 family peptidase | - |
OIS50_RS11845 (OIS50_11845) | 2660495..2660938 | - | 444 | WP_264690850.1 | ribonuclease P protein component | - |
OIS50_RS11850 (OIS50_11850) | 2660985..2661143 | - | 159 | WP_078014902.1 | 50S ribosomal protein L34 | - |
OIS50_RS11855 (OIS50_11855) | 2661284..2663044 | + | 1761 | WP_264690851.1 | PDZ domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11799.75 Da Isoelectric Point: 7.9865
>T263191 WP_264690847.1 NZ_CP110136:c2658283-2657966 [Hymenobacter sp. YIM 151858-1]
MTLWLDAQLSPLLAVWLRWKFGLNASALRDIGLRDAKDEEIFRAARTANAVVVSKDADFLRLLERYGPPPQIIWITCGNT
ANERLQQVLLATLPAALELLAASRW
MTLWLDAQLSPLLAVWLRWKFGLNASALRDIGLRDAKDEEIFRAARTANAVVVSKDADFLRLLERYGPPPQIIWITCGNT
ANERLQQVLLATLPAALELLAASRW
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|