Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 5418475..5419010 | Replicon | chromosome |
| Accession | NZ_CP110131 | ||
| Organism | Methylorubrum extorquens strain NBC_00036 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | OKB92_RS25685 | Protein ID | WP_265222622.1 |
| Coordinates | 5418475..5418765 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | OKB92_RS25690 | Protein ID | WP_265222623.1 |
| Coordinates | 5418762..5419010 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKB92_RS25655 (OKB92_25655) | 5413787..5413987 | + | 201 | WP_003605412.1 | hypothetical protein | - |
| OKB92_RS25660 (OKB92_25660) | 5414210..5414833 | + | 624 | WP_265222617.1 | TetR/AcrR family transcriptional regulator | - |
| OKB92_RS25665 (OKB92_25665) | 5414851..5415195 | - | 345 | WP_003605408.1 | DUF1330 domain-containing protein | - |
| OKB92_RS25670 (OKB92_25670) | 5415198..5415896 | - | 699 | WP_265222618.1 | orotidine-5'-phosphate decarboxylase | - |
| OKB92_RS25675 (OKB92_25675) | 5416221..5417747 | + | 1527 | WP_265222619.1 | alginate export family protein | - |
| OKB92_RS25680 (OKB92_25680) | 5417755..5418417 | - | 663 | WP_265222621.1 | uracil-DNA glycosylase family protein | - |
| OKB92_RS25685 (OKB92_25685) | 5418475..5418765 | - | 291 | WP_265222622.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OKB92_RS25690 (OKB92_25690) | 5418762..5419010 | - | 249 | WP_265222623.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| OKB92_RS25695 (OKB92_25695) | 5419144..5420646 | + | 1503 | WP_265222624.1 | glucose-6-phosphate dehydrogenase | - |
| OKB92_RS25700 (OKB92_25700) | 5420842..5422209 | + | 1368 | WP_265222625.1 | SWIM zinc finger family protein | - |
| OKB92_RS25705 (OKB92_25705) | 5422209..5423792 | + | 1584 | WP_265222626.1 | DUF5691 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11011.56 Da Isoelectric Point: 10.5105
>T263190 WP_265222622.1 NZ_CP110131:c5418765-5418475 [Methylorubrum extorquens]
MSVRLSPRARGDLSRIWDDSAERWGADQADRYIRLLAGGFDRLAEDPARGLRADEIRKGYFRLSVGSHVLFYRLGAEGGI
EVIRILHGRMDFKRHL
MSVRLSPRARGDLSRIWDDSAERWGADQADRYIRLLAGGFDRLAEDPARGLRADEIRKGYFRLSVGSHVLFYRLGAEGGI
EVIRILHGRMDFKRHL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|