Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 3739562..3740154 | Replicon | chromosome |
Accession | NZ_CP110131 | ||
Organism | Methylorubrum extorquens strain NBC_00036 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OKB92_RS18075 | Protein ID | WP_265221661.1 |
Coordinates | 3739562..3739864 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OKB92_RS18080 | Protein ID | WP_265221662.1 |
Coordinates | 3739861..3740154 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKB92_RS18050 (OKB92_18050) | 3735109..3735747 | - | 639 | WP_265221657.1 | L,D-transpeptidase | - |
OKB92_RS18055 (OKB92_18055) | 3735746..3735994 | + | 249 | WP_265221658.1 | hypothetical protein | - |
OKB92_RS18060 (OKB92_18060) | 3736126..3736977 | + | 852 | WP_265221659.1 | histone deacetylase family protein | - |
OKB92_RS18065 (OKB92_18065) | 3737132..3738211 | - | 1080 | WP_015823256.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
OKB92_RS18070 (OKB92_18070) | 3738340..3739440 | - | 1101 | WP_265221660.1 | chorismate synthase | - |
OKB92_RS18075 (OKB92_18075) | 3739562..3739864 | + | 303 | WP_265221661.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OKB92_RS18080 (OKB92_18080) | 3739861..3740154 | + | 294 | WP_265221662.1 | putative addiction module antidote protein | Antitoxin |
OKB92_RS18085 (OKB92_18085) | 3740148..3740771 | - | 624 | WP_265221663.1 | DUF3578 domain-containing protein | - |
OKB92_RS18090 (OKB92_18090) | 3740768..3741901 | - | 1134 | WP_265221664.1 | anhydro-N-acetylmuramic acid kinase | - |
OKB92_RS18095 (OKB92_18095) | 3742042..3743313 | + | 1272 | WP_265221665.1 | tyrosine--tRNA ligase | - |
OKB92_RS18100 (OKB92_18100) | 3743383..3744330 | - | 948 | WP_238506802.1 | fatty acid desaturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11129.87 Da Isoelectric Point: 10.2636
>T263187 WP_265221661.1 NZ_CP110131:3739562-3739864 [Methylorubrum extorquens]
MLEIIRTRTFADWLKGLRDDRAKARIALRIDRLALGHEGDSKAVGGGVSELRIDYGPGYRIYFTYRGKTLVVLLCGGDKA
SQKRDISRAKTLATMLDGTE
MLEIIRTRTFADWLKGLRDDRAKARIALRIDRLALGHEGDSKAVGGGVSELRIDYGPGYRIYFTYRGKTLVVLLCGGDKA
SQKRDISRAKTLATMLDGTE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|