Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 1150712..1151294 | Replicon | chromosome |
Accession | NZ_CP110131 | ||
Organism | Methylorubrum extorquens strain NBC_00036 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | OKB92_RS05485 | Protein ID | WP_265223398.1 |
Coordinates | 1150712..1150987 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | H1KK02 |
Locus tag | OKB92_RS05490 | Protein ID | WP_003600760.1 |
Coordinates | 1150977..1151294 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKB92_RS05470 (OKB92_05470) | 1147778..1148695 | - | 918 | WP_012605511.1 | cytochrome c family protein | - |
OKB92_RS05475 (OKB92_05475) | 1149003..1149746 | + | 744 | WP_265223396.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
OKB92_RS05480 (OKB92_05480) | 1149763..1150620 | + | 858 | WP_265223397.1 | prephenate dehydratase | - |
OKB92_RS05485 (OKB92_05485) | 1150712..1150987 | + | 276 | WP_265223398.1 | BrnT family toxin | Toxin |
OKB92_RS05490 (OKB92_05490) | 1150977..1151294 | + | 318 | WP_003600760.1 | BrnA antitoxin family protein | Antitoxin |
OKB92_RS05495 (OKB92_05495) | 1151402..1152010 | - | 609 | WP_003600761.1 | nucleotide exchange factor GrpE | - |
OKB92_RS05500 (OKB92_05500) | 1152102..1154888 | - | 2787 | WP_265223399.1 | [protein-PII] uridylyltransferase | - |
OKB92_RS05505 (OKB92_05505) | 1155048..1156022 | + | 975 | WP_265223400.1 | aliphatic sulfonate ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10033.51 Da Isoelectric Point: 7.0130
>T263185 WP_265223398.1 NZ_CP110131:1150712-1150987 [Methylorubrum extorquens]
MLIVWDEPKRLTNLQKHGLDFADFEAGFDFETSLVAVAQPSAAGSARMKIIGEFDGQTVVAAIIAPLGREAISLISLRRA
SRSERRLYDAR
MLIVWDEPKRLTNLQKHGLDFADFEAGFDFETSLVAVAQPSAAGSARMKIIGEFDGQTVVAAIIAPLGREAISLISLRRA
SRSERRLYDAR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|