Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 5410751..5411333 | Replicon | chromosome |
Accession | NZ_CP110130 | ||
Organism | Methylorubrum extorquens strain NBC_00404 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | OKC48_RS25620 | Protein ID | WP_012252142.1 |
Coordinates | 5411058..5411333 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | H1KK02 |
Locus tag | OKC48_RS25615 | Protein ID | WP_003600760.1 |
Coordinates | 5410751..5411068 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKC48_RS25600 (OKC48_25600) | 5406023..5406997 | - | 975 | WP_265223400.1 | aliphatic sulfonate ABC transporter substrate-binding protein | - |
OKC48_RS25605 (OKC48_25605) | 5407157..5409943 | + | 2787 | WP_265223399.1 | [protein-PII] uridylyltransferase | - |
OKC48_RS25610 (OKC48_25610) | 5410035..5410643 | + | 609 | WP_003600761.1 | nucleotide exchange factor GrpE | - |
OKC48_RS25615 (OKC48_25615) | 5410751..5411068 | - | 318 | WP_003600760.1 | BrnA antitoxin family protein | Antitoxin |
OKC48_RS25620 (OKC48_25620) | 5411058..5411333 | - | 276 | WP_012252142.1 | BrnT family toxin | Toxin |
OKC48_RS25625 (OKC48_25625) | 5411425..5412282 | - | 858 | WP_265223397.1 | prephenate dehydratase | - |
OKC48_RS25630 (OKC48_25630) | 5412299..5413042 | - | 744 | WP_265223396.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
OKC48_RS25635 (OKC48_25635) | 5413350..5414267 | + | 918 | WP_265244735.1 | c-type cytochrome | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10017.51 Da Isoelectric Point: 7.0130
>T263184 WP_012252142.1 NZ_CP110130:c5411333-5411058 [Methylorubrum extorquens]
MLIVWDEPKRLTNLQKHGLDFADFEAGFDFETALVAVAQPSAAGSARMKIIGEFDGQTVVAAIIAPLGREAISLISLRRA
SRSERRLYDAR
MLIVWDEPKRLTNLQKHGLDFADFEAGFDFETALVAVAQPSAAGSARMKIIGEFDGQTVVAAIIAPLGREAISLISLRRA
SRSERRLYDAR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|