Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2811010..2811602 | Replicon | chromosome |
| Accession | NZ_CP110130 | ||
| Organism | Methylorubrum extorquens strain NBC_00404 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OKC48_RS13125 | Protein ID | WP_265221661.1 |
| Coordinates | 2811300..2811602 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | OKC48_RS13120 | Protein ID | WP_265221662.1 |
| Coordinates | 2811010..2811303 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKC48_RS13100 (OKC48_13100) | 2806834..2807781 | + | 948 | WP_238506802.1 | fatty acid desaturase | - |
| OKC48_RS13105 (OKC48_13105) | 2807851..2809122 | - | 1272 | WP_265221665.1 | tyrosine--tRNA ligase | - |
| OKC48_RS13110 (OKC48_13110) | 2809263..2810396 | + | 1134 | WP_265221664.1 | anhydro-N-acetylmuramic acid kinase | - |
| OKC48_RS13115 (OKC48_13115) | 2810393..2811016 | + | 624 | WP_265221663.1 | DUF3578 domain-containing protein | - |
| OKC48_RS13120 (OKC48_13120) | 2811010..2811303 | - | 294 | WP_265221662.1 | putative addiction module antidote protein | Antitoxin |
| OKC48_RS13125 (OKC48_13125) | 2811300..2811602 | - | 303 | WP_265221661.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OKC48_RS13130 (OKC48_13130) | 2811724..2812824 | + | 1101 | WP_265221660.1 | chorismate synthase | - |
| OKC48_RS13135 (OKC48_13135) | 2812953..2814032 | + | 1080 | WP_015823256.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| OKC48_RS13140 (OKC48_13140) | 2814187..2815038 | - | 852 | WP_265221659.1 | histone deacetylase family protein | - |
| OKC48_RS13145 (OKC48_13145) | 2815170..2815418 | - | 249 | WP_265221658.1 | hypothetical protein | - |
| OKC48_RS13150 (OKC48_13150) | 2815417..2816055 | + | 639 | WP_265221657.1 | L,D-transpeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11129.87 Da Isoelectric Point: 10.2636
>T263182 WP_265221661.1 NZ_CP110130:c2811602-2811300 [Methylorubrum extorquens]
MLEIIRTRTFADWLKGLRDDRAKARIALRIDRLALGHEGDSKAVGGGVSELRIDYGPGYRIYFTYRGKTLVVLLCGGDKA
SQKRDISRAKTLATMLDGTE
MLEIIRTRTFADWLKGLRDDRAKARIALRIDRLALGHEGDSKAVGGGVSELRIDYGPGYRIYFTYRGKTLVVLLCGGDKA
SQKRDISRAKTLATMLDGTE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|